IRF6 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: IRF6 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6246
• Hersteller Artikelnummer: A6246
• Alternativnummer: ABB-A6246-20UL,ABB-A6246-100UL,ABB-A6246-500UL,ABB-A6246-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LPS, PIT, PPS, VWS, OFC6, PPS1, VWS1, IRF6

Produktbeschreibung

This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. The encoded protein may be a transcriptional activator. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. Mutations in this gene are also associated with non-syndromic orofacial cleft type 6. Alternate splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 53kDa
• NCBI: 3664
• UniProt: O14896
• Reinheit: Affinity purification
• Sequenz: DIPQPQGSIINPGSTGSAPWDEKDNDVDEEDEEDELDQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDR
• Target-Kategorie: IRF6
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway,Stem Cells,Embryonic Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using IRF6 Rabbit pAb (A6246) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 15s.