IRF6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6246
Article Name: IRF6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6246
Supplier Catalog Number: A6246
Alternative Catalog Number: ABB-A6246-20UL,ABB-A6246-100UL,ABB-A6246-500UL,ABB-A6246-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LPS, PIT, PPS, VWS, OFC6, PPS1, VWS1, IRF6
This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. The encoded protein may be a transcriptional activator. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. Mutations in this gene are also associated with non-syndromic orofacial cleft type 6. Alternate splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 3664
UniProt: O14896
Purity: Affinity purification
Sequence: DIPQPQGSIINPGSTGSAPWDEKDNDVDEEDEEDELDQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPEHITNEKQKLFTSKLLDVMDR
Target: IRF6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway,Stem Cells,Embryonic Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using IRF6 Rabbit pAb (A6246) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 15s.