DPEP1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: DPEP1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6289
• Hersteller Artikelnummer: A6289
• Alternativnummer: ABB-A6289-100UL,ABB-A6289-20UL,ABB-A6289-500UL,ABB-A6289-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MDP, RDP, MBD1, DPEP1

Produktbeschreibung

The protein encoded by this gene is a kidney membrane enzyme involved in the metabolism of glutathione and other similar proteins by dipeptide hydrolysis. The encoded protein is known to regulate leukotriene activity by catalyzing the conversion of leukotriene D4 to leukotriene E4. This protein uses zinc as a cofactor and acts as a disulfide-linked homodimer.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 46 kDa
• NCBI: 1800
• UniProt: P16444
• Reinheit: Affinity purification
• Sequenz: DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNY
• Target-Kategorie: DPEP1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:100-1:300|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using DPEP1 Rabbit pAb (A6289) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.