DPEP1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: DPEP1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6289
• Supplier Catalog Number: A6289
• Alternative Catalog Number: ABB-A6289-100UL,ABB-A6289-20UL,ABB-A6289-500UL,ABB-A6289-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MDP, RDP, MBD1, DPEP1

Product Description

The protein encoded by this gene is a kidney membrane enzyme involved in the metabolism of glutathione and other similar proteins by dipeptide hydrolysis. The encoded protein is known to regulate leukotriene activity by catalyzing the conversion of leukotriene D4 to leukotriene E4. This protein uses zinc as a cofactor and acts as a disulfide-linked homodimer.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 46 kDa
• NCBI: 1800
• UniProt: P16444
• Purity: Affinity purification
• Sequence: DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNY
• Target: DPEP1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:100-1:300|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag

Images

Western blot analysis of various lysates using DPEP1 Rabbit pAb (A6289) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.