PLEK Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PLEK Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6305
• Hersteller Artikelnummer: A6305
• Alternativnummer: ABB-A6305-100UL,ABB-A6305-20UL,ABB-A6305-1000UL,ABB-A6305-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: P47, PLEK1, PLEK

Produktbeschreibung

Enables phosphatidylinositol-3,4-bisphosphate binding activity, protein homodimerization activity, and protein kinase C binding activity. Involved in several processes, including G protein-coupled receptor signaling pathway, actin cytoskeleton organization, and positive regulation of supramolecular fiber organization. Located in cytoplasm and ruffle membrane.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 40kDa
• NCBI: 5341
• UniProt: P08567
• Reinheit: Affinity purification
• Sequenz: MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQG
• Target-Kategorie: PLEK
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience,Calcium Signaling,Cardiovascular,Blood,Heart. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using PLEK Rabbit pAb (A6305) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.