PLEK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A6305
- Bilder (1)
| Artikelname: | PLEK Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A6305 |
| Hersteller Artikelnummer: | A6305 |
| Alternativnummer: | ABB-A6305-100UL,ABB-A6305-20UL,ABB-A6305-1000UL,ABB-A6305-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | P47, PLEK1, PLEK |
| Enables phosphatidylinositol-3,4-bisphosphate binding activity, protein homodimerization activity, and protein kinase C binding activity. Involved in several processes, including G protein-coupled receptor signaling pathway, actin cytoskeleton organization, and positive regulation of supramolecular fiber organization. Located in cytoplasm and ruffle membrane. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 40kDa |
| NCBI: | 5341 |
| UniProt: | P08567 |
| Reinheit: | Affinity purification |
| Sequenz: | MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQG |
| Target-Kategorie: | PLEK |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience,Calcium Signaling,Cardiovascular,Blood,Heart. Shipping: Ice Bag |

