PLEK Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PLEK Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6305
• Supplier Catalog Number: A6305
• Alternative Catalog Number: ABB-A6305-100UL,ABB-A6305-20UL,ABB-A6305-1000UL,ABB-A6305-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: P47, PLEK1, PLEK

Product Description

Enables phosphatidylinositol-3,4-bisphosphate binding activity, protein homodimerization activity, and protein kinase C binding activity. Involved in several processes, including G protein-coupled receptor signaling pathway, actin cytoskeleton organization, and positive regulation of supramolecular fiber organization. Located in cytoplasm and ruffle membrane.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 40kDa
• NCBI: 5341
• UniProt: P08567
• Purity: Affinity purification
• Sequence: MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQG
• Target: PLEK
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience,Calcium Signaling,Cardiovascular,Blood,Heart. Shipping: Ice Bag

Images

Western blot analysis of various lysates using PLEK Rabbit pAb (A6305) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.