FAIM3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: FAIM3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6320
• Hersteller Artikelnummer: A6320
• Alternativnummer: ABB-A6320-20UL,ABB-A6320-100UL,ABB-A6320-500UL,ABB-A6320-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TOSO, FAIM3, FcmuR

Produktbeschreibung

Fc receptors specifically bind to the Fc region of immunoglobulins (Igs) to mediate the unique functions of each Ig class. FAIM3 encodes an Fc receptor for IgM (see MIM 147020) (Kubagawa et al., 2009 [PubMed 19858324], Shima et al., 2010 [PubMed 20042454]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 43kDa
• NCBI: 9214
• UniProt: O60667
• Reinheit: Affinity purification
• Sequenz: RILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREGQG
• Target-Kategorie: FCMR
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using FAIM3 Rabbit pAb (A6320) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.