FAIM3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: FAIM3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6320
• Supplier Catalog Number: A6320
• Alternative Catalog Number: ABB-A6320-20UL,ABB-A6320-100UL,ABB-A6320-500UL,ABB-A6320-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TOSO, FAIM3, FcmuR

Product Description

Fc receptors specifically bind to the Fc region of immunoglobulins (Igs) to mediate the unique functions of each Ig class. FAIM3 encodes an Fc receptor for IgM (see MIM 147020) (Kubagawa et al., 2009 [PubMed 19858324], Shima et al., 2010 [PubMed 20042454]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 43kDa
• NCBI: 9214
• UniProt: O60667
• Purity: Affinity purification
• Sequence: RILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREGQG
• Target: FCMR
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag

Images

Western blot analysis of various lysates using FAIM3 Rabbit pAb (A6320) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.