CFDP1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CFDP1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6325
• Hersteller Artikelnummer: A6325
• Alternativnummer: ABB-A6325-20UL,ABB-A6325-100UL,ABB-A6325-1000UL,ABB-A6325-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: p97, BCNT, CP27, SWC5, Yeti, CENP-29, BUCENTAUR, CFDP1

Produktbeschreibung

Predicted to act upstream of or within several processes, including cell adhesion, negative regulation of fibroblast apoptotic process, and regulation of cell shape. Predicted to be located in kinetochore.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 34kDa
• NCBI: 10428
• UniProt: Q9UEE9
• Reinheit: Affinity purification
• Sequenz: MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEE
• Target-Kategorie: CFDP1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Stem Cells,Mesenchymal Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CFDP1 Rabbit pAb (A6325) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.