CFDP1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CFDP1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6325
• Supplier Catalog Number: A6325
• Alternative Catalog Number: ABB-A6325-20UL,ABB-A6325-100UL,ABB-A6325-1000UL,ABB-A6325-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: p97, BCNT, CP27, SWC5, Yeti, CENP-29, BUCENTAUR, CFDP1

Product Description

Predicted to act upstream of or within several processes, including cell adhesion, negative regulation of fibroblast apoptotic process, and regulation of cell shape. Predicted to be located in kinetochore.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 34kDa
• NCBI: 10428
• UniProt: Q9UEE9
• Purity: Affinity purification
• Sequence: MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEE
• Target: CFDP1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Stem Cells,Mesenchymal Stem Cells. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CFDP1 Rabbit pAb (A6325) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.