DUSP13 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: DUSP13 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6464
• Hersteller Artikelnummer: A6464
• Alternativnummer: ABB-A6464-100UL,ABB-A6464-20UL,ABB-A6464-1000UL,ABB-A6464-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MDSP, TMDP, SKRP4, DUSP13

Produktbeschreibung

Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This gene encodes a dual specificity phosphatase that acts on both phosphotyrosine and phosphoserine/threonine residues. The encoded protein is expressed in testis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 6kDa/7kDa/9kDa/17kDa/20kDa/22kDa/27kDa
• NCBI: 51207
• UniProt: Q6B8I1
• Reinheit: Affinity purification
• Sequenz: MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF
• Target-Kategorie: DUSP13B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using DUSP13 Rabbit pAb (A6464) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.