DUSP13 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: DUSP13 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6464
• Supplier Catalog Number: A6464
• Alternative Catalog Number: ABB-A6464-100UL,ABB-A6464-20UL,ABB-A6464-1000UL,ABB-A6464-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MDSP, TMDP, SKRP4, DUSP13

Product Description

Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This gene encodes a dual specificity phosphatase that acts on both phosphotyrosine and phosphoserine/threonine residues. The encoded protein is expressed in testis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 6kDa/7kDa/9kDa/17kDa/20kDa/22kDa/27kDa
• NCBI: 51207
• UniProt: Q6B8I1
• Purity: Affinity purification
• Sequence: MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF
• Target: DUSP13B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag

Images

Western blot analysis of various lysates using DUSP13 Rabbit pAb (A6464) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.