AHSP Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: AHSP Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6465
• Hersteller Artikelnummer: A6465
• Alternativnummer: ABB-A6465-20UL,ABB-A6465-100UL,ABB-A6465-500UL,ABB-A6465-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EDRF, ERAF, AHSP

Produktbeschreibung

This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 12kDa
• NCBI: 51327
• UniProt: Q9NZD4
• Reinheit: Affinity purification
• Sequenz: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
• Target-Kategorie: AHSP
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Stem Cells,Hematopoietic Progenitors,Cardiovascular,Blood. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using AHSP Rabbit pAb (A6465) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.