AHSP Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: AHSP Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6465
• Supplier Catalog Number: A6465
• Alternative Catalog Number: ABB-A6465-20UL,ABB-A6465-100UL,ABB-A6465-500UL,ABB-A6465-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EDRF, ERAF, AHSP

Product Description

This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 12kDa
• NCBI: 51327
• UniProt: Q9NZD4
• Purity: Affinity purification
• Sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
• Target: AHSP
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Stem Cells,Hematopoietic Progenitors,Cardiovascular,Blood. Shipping: Ice Bag

Images

Western blot analysis of various lysates using AHSP Rabbit pAb (A6465) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.