KIF2B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A6480
- Bilder (1)
| Artikelname: | KIF2B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A6480 |
| Hersteller Artikelnummer: | A6480 |
| Alternativnummer: | ABB-A6480-20UL,ABB-A6480-100UL,ABB-A6480-500UL,ABB-A6480-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIF2B |
| Predicted to enable microtubule binding activity and microtubule motor activity. Involved in metaphase plate congression, microtubule depolymerization, and regulation of chromosome segregation. Located in intercellular bridge, mitotic spindle, and nucleolus. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 76kDa |
| NCBI: | 84643 |
| UniProt: | Q8N4N8 |
| Reinheit: | Affinity purification |
| Sequenz: | NVDVRPYHRGHYPIGHEAPRMLKSHIGNSEMSLQRDEFIKIPYVQSEEQKEIEEVETLPTLLGKDTTISGKGSSQWLENIQERAGGVHHDIDFCIARSLSILEQKIDALTEIQKKLKLLLADLHVKSKVE |
| Target-Kategorie: | KIF2B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cytoskeleton,Motor Proteins,Immunology Inflammation,Cytokines. Shipping: Ice Bag |

