KIF2B Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: KIF2B Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6480
• Hersteller Artikelnummer: A6480
• Alternativnummer: ABB-A6480-20UL,ABB-A6480-100UL,ABB-A6480-500UL,ABB-A6480-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: KIF2B

Produktbeschreibung

Predicted to enable microtubule binding activity and microtubule motor activity. Involved in metaphase plate congression, microtubule depolymerization, and regulation of chromosome segregation. Located in intercellular bridge, mitotic spindle, and nucleolus.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 76kDa
• NCBI: 84643
• UniProt: Q8N4N8
• Reinheit: Affinity purification
• Sequenz: NVDVRPYHRGHYPIGHEAPRMLKSHIGNSEMSLQRDEFIKIPYVQSEEQKEIEEVETLPTLLGKDTTISGKGSSQWLENIQERAGGVHHDIDFCIARSLSILEQKIDALTEIQKKLKLLLADLHVKSKVE
• Target-Kategorie: KIF2B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cytoskeleton,Motor Proteins,Immunology Inflammation,Cytokines. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using KIF2B Rabbit pAb (A6480) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.