KIF2B Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: KIF2B Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6480
• Supplier Catalog Number: A6480
• Alternative Catalog Number: ABB-A6480-20UL,ABB-A6480-100UL,ABB-A6480-500UL,ABB-A6480-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: KIF2B

Product Description

Predicted to enable microtubule binding activity and microtubule motor activity. Involved in metaphase plate congression, microtubule depolymerization, and regulation of chromosome segregation. Located in intercellular bridge, mitotic spindle, and nucleolus.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 76kDa
• NCBI: 84643
• UniProt: Q8N4N8
• Purity: Affinity purification
• Sequence: NVDVRPYHRGHYPIGHEAPRMLKSHIGNSEMSLQRDEFIKIPYVQSEEQKEIEEVETLPTLLGKDTTISGKGSSQWLENIQERAGGVHHDIDFCIARSLSILEQKIDALTEIQKKLKLLLADLHVKSKVE
• Target: KIF2B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cytoskeleton,Motor Proteins,Immunology Inflammation,Cytokines. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using KIF2B Rabbit pAb (A6480) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.