GNAT1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A6496
Artikelname: GNAT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A6496
Hersteller Artikelnummer: A6496
Alternativnummer: ABB-A6496-20UL,ABB-A6496-100UL,ABB-A6496-1000UL,ABB-A6496-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GBT1, HG1F, GNATR, CSNB1G, CSNBAD3, GNAT1
Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in rods. This gene is also expressed in other cells, and has been implicated in bitter taste transduction in rat taste cells. Mutations in this gene result in autosomal dominant congenital stationary night blindness. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 2779
UniProt: P11488
Reinheit: Affinity purification
Sequenz: SLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFERASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTT
Target-Kategorie: GNAT1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using GNAT1 Rabbit pAb (A6496) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.