GNAT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6496
Article Name: GNAT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6496
Supplier Catalog Number: A6496
Alternative Catalog Number: ABB-A6496-20UL,ABB-A6496-100UL,ABB-A6496-1000UL,ABB-A6496-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GBT1, HG1F, GNATR, CSNB1G, CSNBAD3, GNAT1
Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in rods. This gene is also expressed in other cells, and has been implicated in bitter taste transduction in rat taste cells. Mutations in this gene result in autosomal dominant congenital stationary night blindness. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 2779
UniProt: P11488
Purity: Affinity purification
Sequence: SLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFERASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTT
Target: GNAT1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using GNAT1 Rabbit pAb (A6496) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.