ATOH1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ATOH1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6530
• Hersteller Artikelnummer: A6530
• Alternativnummer: ABB-A6530-100UL,ABB-A6530-20UL,ABB-A6530-500UL,ABB-A6530-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ATH1, HATH1, DFNA89, MATH-1, bHLHa14, ATOH1

Produktbeschreibung

Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in neuron differentiation, positive regulation of neuron differentiation, and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including generation of neurons, inner ear morphogenesis, and positive regulation of inner ear auditory receptor cell differentiation. Predicted to be part of chromatin. Predicted to be active in nucleus.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 38kDa
• NCBI: 474
• UniProt: Q92858
• Reinheit: Affinity purification
• Sequenz: LQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
• Target-Kategorie: ATOH1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Apoptosis,Neuroscience,Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ATOH1 Rabbit pAb (A6530) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.