ATOH1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6530
Article Name: ATOH1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6530
Supplier Catalog Number: A6530
Alternative Catalog Number: ABB-A6530-100UL,ABB-A6530-20UL,ABB-A6530-500UL,ABB-A6530-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ATH1, HATH1, DFNA89, MATH-1, bHLHa14, ATOH1
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in neuron differentiation, positive regulation of neuron differentiation, and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including generation of neurons, inner ear morphogenesis, and positive regulation of inner ear auditory receptor cell differentiation. Predicted to be part of chromatin. Predicted to be active in nucleus.
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 474
UniProt: Q92858
Purity: Affinity purification
Sequence: LQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Target: ATOH1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Apoptosis,Neuroscience,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using ATOH1 Rabbit pAb (A6530) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.