ATP6AP2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ATP6AP2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6531
• Hersteller Artikelnummer: A6531
• Alternativnummer: ABB-A6531-20UL,ABB-A6531-100UL,ABB-A6531-1000UL,ABB-A6531-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PRR, M8-9, MRXE, RENR, XMRE, XPDS, CDG2R, HT028, MRXSH, ELDF10, ATP6IP2, MSTP009, APT6M8-9, ATP6M8-9, ATP6AP2

Produktbeschreibung

This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 39kDa
• NCBI: 10159
• UniProt: O75787
• Reinheit: Affinity purification
• Sequenz: MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
• Target-Kategorie: ATP6AP2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using ATP6AP2 Rabbit pAb (A6531) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.