ATP6AP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6531
Article Name: ATP6AP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6531
Supplier Catalog Number: A6531
Alternative Catalog Number: ABB-A6531-20UL,ABB-A6531-100UL,ABB-A6531-1000UL,ABB-A6531-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PRR, M8-9, MRXE, RENR, XMRE, XPDS, CDG2R, HT028, MRXSH, ELDF10, ATP6IP2, MSTP009, APT6M8-9, ATP6M8-9, ATP6AP2
This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 10159
UniProt: O75787
Purity: Affinity purification
Sequence: MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Target: ATP6AP2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using ATP6AP2 Rabbit pAb (A6531) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.