Langerin/CD207 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Langerin/CD207 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6553
• Hersteller Artikelnummer: A6553
• Alternativnummer: ABB-A6553-100UL,ABB-A6553-20UL,ABB-A6553-500UL,ABB-A6553-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CLEC4K, Langerin/CD207

Produktbeschreibung

The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. Mutations in this gene result in Birbeck granules deficiency or loss of sugar binding activity.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 37kDa
• NCBI: 50489
• UniProt: Q9UJ71
• Reinheit: Affinity purification
• Sequenz: TISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWK
• Target-Kategorie: CD207
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Immunology Inflammation,CDs. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using Langerin/CD207 Rabbit pAb (A6553) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.