Langerin/CD207 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6553
Article Name: Langerin/CD207 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6553
Supplier Catalog Number: A6553
Alternative Catalog Number: ABB-A6553-100UL,ABB-A6553-20UL,ABB-A6553-500UL,ABB-A6553-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CLEC4K, Langerin/CD207
The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. Mutations in this gene result in Birbeck granules deficiency or loss of sugar binding activity.
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 50489
UniProt: Q9UJ71
Purity: Affinity purification
Sequence: TISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWK
Target: CD207
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates using Langerin/CD207 Rabbit pAb (A6553) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.