FRZB Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: FRZB Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6592
• Hersteller Artikelnummer: A6592
• Alternativnummer: ABB-A6592-20UL,ABB-A6592-100UL,ABB-A6592-500UL,ABB-A6592-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FRE, OS1, FZRB, hFIZ, FRITZ, FRP-3, FRZB1, SFRP3, SRFP3, FRZB-1, FRZB-PEN, FRZB

Produktbeschreibung

The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 36kDa
• NCBI: 2487
• UniProt: Q92765
• Reinheit: Affinity purification
• Sequenz: SNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN
• Target-Kategorie: FRZB
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:2000 - 1:7000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Rat,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone,Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat spleen, using FRZB Rabbit pAb (A6592) at 1:6000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.