FRZB Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: FRZB Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6592
• Supplier Catalog Number: A6592
• Alternative Catalog Number: ABB-A6592-20UL,ABB-A6592-100UL,ABB-A6592-500UL,ABB-A6592-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FRE, OS1, FZRB, hFIZ, FRITZ, FRP-3, FRZB1, SFRP3, SRFP3, FRZB-1, FRZB-PEN, FRZB

Product Description

The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 36kDa
• NCBI: 2487
• UniProt: Q92765
• Purity: Affinity purification
• Sequence: SNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN
• Target: FRZB
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:2000 - 1:7000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone,Stem Cells. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat spleen, using FRZB Rabbit pAb (A6592) at 1:6000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.