GALNT3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A6596
- Bilder (1)
| Artikelname: | GALNT3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A6596 |
| Hersteller Artikelnummer: | A6596 |
| Alternativnummer: | ABB-A6596-20UL,ABB-A6596-100UL,ABB-A6596-1000UL,ABB-A6596-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HHS, HFTC, HFTC1, GalNAc-T3, GALNT3 |
| This gene encodes UDP-GalNAc transferase 3, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation is regulated by a repertoire of GalNAc-transferases. The protein encoded by this gene is highly homologous to other family members, however the enzymes have different substrate specificities. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 73kDa |
| NCBI: | 2591 |
| UniProt: | Q14435 |
| Reinheit: | Affinity purification |
| Sequenz: | MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKE |
| Target-Kategorie: | GALNT3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using GALNT3 Rabbit pAb (A6596) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
