GALNT3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GALNT3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6596
• Supplier Catalog Number: A6596
• Alternative Catalog Number: ABB-A6596-20UL,ABB-A6596-100UL,ABB-A6596-1000UL,ABB-A6596-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HHS, HFTC, HFTC1, GalNAc-T3, GALNT3

Product Description

This gene encodes UDP-GalNAc transferase 3, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation is regulated by a repertoire of GalNAc-transferases. The protein encoded by this gene is highly homologous to other family members, however the enzymes have different substrate specificities.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 73kDa
• NCBI: 2591
• UniProt: Q14435
• Purity: Affinity purification
• Sequence: MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKE
• Target: GALNT3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. Shipping: Ice Bag

Images

Western blot analysis of various lysates using GALNT3 Rabbit pAb (A6596) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.