GBE1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: GBE1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6599
• Hersteller Artikelnummer: A6599
• Alternativnummer: ABB-A6599-20UL,ABB-A6599-100UL,ABB-A6599-1000UL,ABB-A6599-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GBE, APBD, GSD4, GBE1

Produktbeschreibung

The protein encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersens disease).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 80kDa
• NCBI: 2632
• UniProt: Q04446
• Reinheit: Affinity purification
• Sequenz: MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITS
• Target-Kategorie: GBE1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using GBE1 Rabbit pAb (A6599) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.