GBE1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GBE1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6599
• Supplier Catalog Number: A6599
• Alternative Catalog Number: ABB-A6599-20UL,ABB-A6599-100UL,ABB-A6599-1000UL,ABB-A6599-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GBE, APBD, GSD4, GBE1

Product Description

The protein encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersens disease).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 80kDa
• NCBI: 2632
• UniProt: Q04446
• Purity: Affinity purification
• Sequence: MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITS
• Target: GBE1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates using GBE1 Rabbit pAb (A6599) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.