GPAM Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: GPAM Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6610
• Hersteller Artikelnummer: A6610
• Alternativnummer: ABB-A6610-100UL,ABB-A6610-20UL,ABB-A6610-500UL,ABB-A6610-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment). This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GPAT, GPAT1, GPAM

Produktbeschreibung

This gene encodes a mitochondrial enzyme which prefers saturated fatty acids as its substrate for the synthesis of glycerolipids. This metabolic pathways first step is catalyzed by the encoded enzyme. Two forms for this enzyme exist, one in the mitochondria and one in the endoplasmic reticulum. Two alternatively spliced transcript variants have been described for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 94 kDa
• NCBI: 57678
• UniProt: Q9HCL2
• Reinheit: Affinity purification
• Sequenz: LNKRGLGGPTSTPPNLISQEQLVRKAASLCYLLSNEGTISLPCQTFYQVCHETVGKFIQYGILTVAEHDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITFLQRLLGPLLEAYSSAAIFVHNFSGPVPEPEYLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL
• Target-Kategorie: GPAM

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using (A6610) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.