GPAM Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GPAM Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6610
• Supplier Catalog Number: A6610
• Alternative Catalog Number: ABB-A6610-100UL,ABB-A6610-20UL,ABB-A6610-500UL,ABB-A6610-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment). This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GPAT, GPAT1, GPAM

Product Description

This gene encodes a mitochondrial enzyme which prefers saturated fatty acids as its substrate for the synthesis of glycerolipids. This metabolic pathways first step is catalyzed by the encoded enzyme. Two forms for this enzyme exist, one in the mitochondria and one in the endoplasmic reticulum. Two alternatively spliced transcript variants have been described for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 94 kDa
• NCBI: 57678
• UniProt: Q9HCL2
• Purity: Affinity purification
• Sequence: LNKRGLGGPTSTPPNLISQEQLVRKAASLCYLLSNEGTISLPCQTFYQVCHETVGKFIQYGILTVAEHDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITFLQRLLGPLLEAYSSAAIFVHNFSGPVPEPEYLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL
• Target: GPAM

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag

Images

Western blot analysis of various lysates using (A6610) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.