IRAK2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A6635
- Bilder (1)
| Artikelname: | IRAK2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A6635 |
| Hersteller Artikelnummer: | A6635 |
| Alternativnummer: | ABB-A6635-20UL,ABB-A6635-100UL,ABB-A6635-1000UL,ABB-A6635-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IRAK-2, IRAK2 |
| IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 69kDa |
| NCBI: | 3656 |
| UniProt: | O43187 |
| Reinheit: | Affinity purification |
| Sequenz: | MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIERFFQ |
| Target-Kategorie: | IRAK2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Serine threonine kinases,Immunology Inflammation,Cytokines,Interleukins,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling. Shipping: Ice Bag |

