IRAK2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: IRAK2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6635
• Hersteller Artikelnummer: A6635
• Alternativnummer: ABB-A6635-20UL,ABB-A6635-100UL,ABB-A6635-1000UL,ABB-A6635-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: IRAK-2, IRAK2

Produktbeschreibung

IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 69kDa
• NCBI: 3656
• UniProt: O43187
• Reinheit: Affinity purification
• Sequenz: MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIERFFQ
• Target-Kategorie: IRAK2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Serine threonine kinases,Immunology Inflammation,Cytokines,Interleukins,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using IRAK2 Rabbit pAb (A6635) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.