IRAK2 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: IRAK2 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6635
• Supplier Catalog Number: A6635
• Alternative Catalog Number: ABB-A6635-20UL,ABB-A6635-100UL,ABB-A6635-1000UL,ABB-A6635-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: IRAK-2, IRAK2

Product Description

IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of NF-kappaB.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 69kDa
• NCBI: 3656
• UniProt: O43187
• Purity: Affinity purification
• Sequence: MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLRETACSSPGSIERFFQ
• Target: IRAK2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Serine threonine kinases,Immunology Inflammation,Cytokines,Interleukins,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling. Shipping: Ice Bag

Images

Western blot analysis of various lysates using IRAK2 Rabbit pAb (A6635) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.