Pannexin 1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Pannexin 1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6683
• Hersteller Artikelnummer: A6683
• Alternativnummer: ABB-A6683-20UL,ABB-A6683-100UL,ABB-A6683-1000UL,ABB-A6683-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PX1, MRS1, OOMD7, OZEMA7, UNQ2529, Pannexin 1

Produktbeschreibung

The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 48kDa
• NCBI: 24145
• UniProt: Q96RD7
• Reinheit: Affinity purification
• Sequenz: ISLAFAQEISIGTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLKFIMEELDKVY
• Target-Kategorie: PANX1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using Pannexin 1 Rabbit pAb (A6683) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.