Pannexin 1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Pannexin 1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6683
• Supplier Catalog Number: A6683
• Alternative Catalog Number: ABB-A6683-20UL,ABB-A6683-100UL,ABB-A6683-1000UL,ABB-A6683-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PX1, MRS1, OOMD7, OZEMA7, UNQ2529, Pannexin 1

Product Description

The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 48kDa
• NCBI: 24145
• UniProt: Q96RD7
• Purity: Affinity purification
• Sequence: ISLAFAQEISIGTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLKFIMEELDKVY
• Target: PANX1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Neuroscience. Shipping: Ice Bag

Images

Western blot analysis of various lysates using Pannexin 1 Rabbit pAb (A6683) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.