POU2AF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A6696
- Bilder (1)
| Artikelname: | POU2AF1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A6696 |
| Hersteller Artikelnummer: | A6696 |
| Alternativnummer: | ABB-A6696-100UL,ABB-A6696-20UL,ABB-A6696-1000UL,ABB-A6696-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BOB1, OBF1, OCAB, OBF-1, POU2AF1 |
| Enables transcription coactivator activity. Involved in positive regulation of transcription by RNA polymerase II. Part of RNA polymerase II transcription regulator complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 27kDa |
| NCBI: | 5450 |
| UniProt: | Q16633 |
| Reinheit: | Affinity purification |
| Sequenz: | MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEG |
| Target-Kategorie: | POU2AF1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Immunology Inflammation. Shipping: Ice Bag |

