POU2AF1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: POU2AF1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6696
• Supplier Catalog Number: A6696
• Alternative Catalog Number: ABB-A6696-100UL,ABB-A6696-20UL,ABB-A6696-1000UL,ABB-A6696-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BOB1, OBF1, OCAB, OBF-1, POU2AF1

Product Description

Enables transcription coactivator activity. Involved in positive regulation of transcription by RNA polymerase II. Part of RNA polymerase II transcription regulator complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 27kDa
• NCBI: 5450
• UniProt: Q16633
• Purity: Affinity purification
• Sequence: MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEG
• Target: POU2AF1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Immunology Inflammation. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using POU2AF1 Rabbit pAb (A6696) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.