RAB4A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A6712
Artikelname: RAB4A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A6712
Hersteller Artikelnummer: A6712
Alternativnummer: ABB-A6712-100UL,ABB-A6712-20UL,ABB-A6712-1000UL,ABB-A6712-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RAB4, HRES1, HRES-1, HRES-1/RAB4, RAB4A
This gene is a member of the largest group in the Ras superfamily of small GTPases, which regulate membrane trafficking. The encoded protein is associated with early endosomes and is involved in their sorting and recycling. The protein also plays a role in regulating the recycling of receptors from endosomes to the plasma membrane. Alternatively spliced transcript variants have been observed for this gene.
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 5867
UniProt: P20338
Reinheit: Affinity purification
Sequenz: FGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENEL
Target-Kategorie: RAB4A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag
Western blot analysis of various lysates using RAB4A Rabbit pAb (A6712) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.