RAB4A Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: RAB4A Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6712
• Supplier Catalog Number: A6712
• Alternative Catalog Number: ABB-A6712-100UL,ABB-A6712-20UL,ABB-A6712-1000UL,ABB-A6712-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RAB4, HRES1, HRES-1, HRES-1/RAB4, RAB4A

Product Description

This gene is a member of the largest group in the Ras superfamily of small GTPases, which regulate membrane trafficking. The encoded protein is associated with early endosomes and is involved in their sorting and recycling. The protein also plays a role in regulating the recycling of receptors from endosomes to the plasma membrane. Alternatively spliced transcript variants have been observed for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 5867
• UniProt: P20338
• Purity: Affinity purification
• Sequence: FGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENEL
• Target: RAB4A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag

Images

Western blot analysis of various lysates using RAB4A Rabbit pAb (A6712) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.