RGS7 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: RGS7 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6720
• Hersteller Artikelnummer: A6720
• Alternativnummer: ABB-A6720-20UL,ABB-A6720-100UL,ABB-A6720-500UL,ABB-A6720-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RGS7

Produktbeschreibung

Enables G-protein beta-subunit binding activity and GTPase activator activity. Involved in positive regulation of GTPase activity. Located in cytosol.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 58kDa
• NCBI: 6000
• UniProt: P49802
• Reinheit: Affinity purification
• Sequenz: MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTE
• Target-Kategorie: RGS7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Small G proteins,G-Protein-Coupled Receptors Signaling to MAPK Erk. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from mouse brain, using RGS7 Rabbit pAb (A6720) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.