RGS7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6720
Article Name: RGS7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6720
Supplier Catalog Number: A6720
Alternative Catalog Number: ABB-A6720-20UL,ABB-A6720-100UL,ABB-A6720-500UL,ABB-A6720-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RGS7
Enables G-protein beta-subunit binding activity and GTPase activator activity. Involved in positive regulation of GTPase activity. Located in cytosol.
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 6000
UniProt: P49802
Purity: Affinity purification
Sequence: MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTE
Target: RGS7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Small G proteins,G-Protein-Coupled Receptors Signaling to MAPK Erk. Shipping: Ice Bag
Western blot analysis of lysates from mouse brain, using RGS7 Rabbit pAb (A6720) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.