RPH3A Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: RPH3A Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6722
• Hersteller Artikelnummer: A6722
• Alternativnummer: ABB-A6722-100UL,ABB-A6722-20UL,ABB-A6722-500UL,ABB-A6722-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RPH3A

Produktbeschreibung

The protein encoded by this gene is thought to be an effector for RAB3A, which is a small G protein that acts in the late stages of neurotransmitter exocytosis. The encoded protein may be involved in neurotransmitter release and synaptic vesicle traffic.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 77kDa
• NCBI: 22895
• UniProt: Q9Y2J0
• Reinheit: Affinity purification
• Sequenz: MTDTVFSNSSNRWMYPSDRPLQSKLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVETNNRLHSVWLCKICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQPVSEPAAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGNYGPPVRRASEARMSSSSRDSESWDHSGGAGD
• Target-Kategorie: RPH3A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using RPH3A Rabbit pAb (A6722) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.