RPH3A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A6722
Article Name: RPH3A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A6722
Supplier Catalog Number: A6722
Alternative Catalog Number: ABB-A6722-100UL,ABB-A6722-20UL,ABB-A6722-500UL,ABB-A6722-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RPH3A
The protein encoded by this gene is thought to be an effector for RAB3A, which is a small G protein that acts in the late stages of neurotransmitter exocytosis. The encoded protein may be involved in neurotransmitter release and synaptic vesicle traffic.
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 22895
UniProt: Q9Y2J0
Purity: Affinity purification
Sequence: MTDTVFSNSSNRWMYPSDRPLQSKLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVETNNRLHSVWLCKICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQPVSEPAAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGNYGPPVRRASEARMSSSSRDSESWDHSGGAGD
Target: RPH3A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag
Western blot analysis of various lysates using RPH3A Rabbit pAb (A6722) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.