POLR2F Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A6837
Artikelname: POLR2F Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A6837
Hersteller Artikelnummer: A6837
Alternativnummer: ABB-A6837-20UL,ABB-A6837-100UL,ABB-A6837-1000UL,ABB-A6837-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RPB6, POLRF, RPC15, RPABC2, RPB14.4, HRBP14.4, RPABC14.4, POLR2F
This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 5435
UniProt: P61218
Reinheit: Affinity purification
Sequenz: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
Target-Kategorie: POLR2F
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag
Western blot analysis of lysates from rat heart, using POLR2F Rabbit pAb (A6837) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.