POLR2F Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: POLR2F Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6837
• Supplier Catalog Number: A6837
• Alternative Catalog Number: ABB-A6837-20UL,ABB-A6837-100UL,ABB-A6837-1000UL,ABB-A6837-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RPB6, POLRF, RPC15, RPABC2, RPB14.4, HRBP14.4, RPABC14.4, POLR2F

Product Description

This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 14kDa
• NCBI: 5435
• UniProt: P61218
• Purity: Affinity purification
• Sequence: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
• Target: POLR2F
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag

Images

Western blot analysis of lysates from rat heart, using POLR2F Rabbit pAb (A6837) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.