HOXB7 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: HOXB7 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6925
• Hersteller Artikelnummer: A6925
• Alternativnummer: ABB-A6925-100UL,ABB-A6925-20UL,ABB-A6925-500UL,ABB-A6925-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HOX2, HOX2C, HHO.C1, Hox-2.3, HOXB7

Produktbeschreibung

This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 24kDa
• NCBI: 3217
• UniProt: P09629
• Reinheit: Affinity purification
• Sequenz: MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
• Target-Kategorie: HOXB7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Mouse kidney, using HOXB7 Rabbit pAb (A6925) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.