HOXB7 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: HOXB7 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6925
• Supplier Catalog Number: A6925
• Alternative Catalog Number: ABB-A6925-100UL,ABB-A6925-20UL,ABB-A6925-500UL,ABB-A6925-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HOX2, HOX2C, HHO.C1, Hox-2.3, HOXB7

Product Description

This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 3217
• UniProt: P09629
• Purity: Affinity purification
• Sequence: MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
• Target: HOXB7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse kidney, using HOXB7 Rabbit pAb (A6925) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.