PTPRO Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PTPRO Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A6958
• Hersteller Artikelnummer: A6958
• Alternativnummer: ABB-A6958-20UL,ABB-A6958-100UL,ABB-A6958-1000UL,ABB-A6958-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NPHS6, PTPU2, GLEPP1, PTP-OC, PTP-U2, PTPROT, R-PTP-O, PTPRO

Produktbeschreibung

This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 138kDa
• NCBI: 5800
• UniProt: Q16827
• Reinheit: Affinity purification
• Sequenz: FHVTVQDDNNIVVSLEASDVISPASVYVVKITGESKNYFFEFEEFNSTLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWP
• Target-Kategorie: PTPRO
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Mouse kidney, using PTPRO Rabbit pAb (A6958) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.