PTPRO Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PTPRO Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A6958
• Supplier Catalog Number: A6958
• Alternative Catalog Number: ABB-A6958-20UL,ABB-A6958-100UL,ABB-A6958-1000UL,ABB-A6958-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NPHS6, PTPU2, GLEPP1, PTP-OC, PTP-U2, PTPROT, R-PTP-O, PTPRO

Product Description

This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This gene contains two distinct promoters, and alternatively spliced transcript variants encoding multiple isoforms have been observed. The encoded proteins may have multiple isoform-specific and tissue-specific functions, including the regulation of osteoclast production and activity, inhibition of cell proliferation and facilitation of apoptosis. This gene is a candidate tumor suppressor, and decreased expression of this gene has been observed in several types of cancer.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 138kDa
• NCBI: 5800
• UniProt: Q16827
• Purity: Affinity purification
• Sequence: FHVTVQDDNNIVVSLEASDVISPASVYVVKITGESKNYFFEFEEFNSTLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWP
• Target: PTPRO
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse kidney, using PTPRO Rabbit pAb (A6958) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.